PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR12G04190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 379aa    MW: 43062.5 Da    PI: 6.5114
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR12G04190.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.23e-16132178148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd +lv++v+q+G + W+ I   ++ gR +kqc++rw+++l
  LPERR12G04190.1 132 KGHWTLEEDRKLVKLVEQFGLKKWSQIGGILP-GRVGKQCRERWYNHL 178
                      789*****************************.*************97 PP

2Myb_DNA-binding53.27e-17184226145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++W++eEd  l++ +k+ G++ W+ Ia++++ gRt++++k++w+
  LPERR12G04190.1 184 KDNWSEEEDMVLIQIHKEVGNR-WAEIAKRLP-GRTENSIKNHWN 226
                      689*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.402127182IPR017930Myb domain
SuperFamilySSF466893.38E-31130225IPR009057Homeodomain-like
SMARTSM007175.4E-15131180IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-26133186IPR009057Homeodomain-like
CDDcd001675.56E-14135178No hitNo description
PfamPF139211.1E-18135192No hitNo description
PROSITE profilePS5129420.061183233IPR017930Myb domain
SMARTSM007177.0E-17183231IPR001005SANT/Myb domain
CDDcd001673.61E-13186229No hitNo description
Gene3DG3DSA:1.10.10.604.5E-22187231IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MDFSCFIPQP VISDTMQFQP FEQQELHPVV LDHPFEAEGI TVHESALAGG SVHPFTTLHD  60
IDHELFRRGI RKDVIIDNAS SIFLLNPKSE VSHLVRGVNF GGYGAGGYEM NGRLISRKKT  120
SRKATKKAGA VKGHWTLEED RKLVKLVEQF GLKKWSQIGG ILPGRVGKQC RERWYNHLRP  180
NIKKDNWSEE EDMVLIQIHK EVGNRWAEIA KRLPGRTENS IKNHWNATKR RQFARKRNRS  240
TSKSASTVLQ NYIKSIAIDP LSPQESQMND ERLEFNSSDM MLTQGTLCLD ENNCSHSHTS  300
EGHIVPGCDG FATEMWSGLF DAKEDEEETQ YLLYDIDTDV DLNCIFSHMD YASNIEPGFT  360
SLVTPEGSAE SRAMHLKMD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C8e-431312333105C-Myb DNA-Binding Domain
1msf_C8e-431312333105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664387.10.0PREDICTED: uncharacterized protein LOC102717115
TrEMBLA0A0D9XXE50.0A0A0D9XXE5_9ORYZ; Uncharacterized protein
STRINGBGIOSGA036541-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-62myb domain protein 98